Novus Biologicals

Browse a range of Novus Biologicals antibodies, proteins, stains, kits, research reagents, and other products to support your scientific needs.

Narrow Results

special interests

Small and Specialty Supplier (760,346)

Classification

Monoclonal (372,565)
Polyclonal (336,514)

Regulatory Status

RUO (637,708)

1 – 15 of 713,524 results

Collagen I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 195 publications

Pricing & Availability

Novus Biologicals™ LPS from E. Coli, TLR4 ligand

Applications: Functional

Pricing & Availability

alpha-Synuclein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Pricing & Availability

SCF/c-kit Ligand Rabbit anti-Human, Clone: 4, Novus Biologicals™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA
Form	Purified
Isotype	IgG
Research Discipline	Biologically Active Proteins, Cancer, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Stem Cell Markers
Antigen	SCF/c-kit Ligand
Regulatory Status	RUO
Purification Method	Protein A purified
Dilution	ELISA 1:5000-1:10000, Sandwich ELISA Detection 1:1000-1:10000
Gene Alias	DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, KIT ligand, Kitl, KL-1, Mast cell growth factor, MGFSHEP7, SCFStem cell factor, SFc-Kit ligand, steel factor
Gene ID (Entrez)	4254
Formulation	0.2 um filtered solution in PBS
Immunogen	Recombinant Human SCF/c-kit Ligand protein
Classification	Monoclonal
Primary or Secondary	Primary
Clone	4

Novus Biologicals™ Glucose Assay Kit (Colorimetric)

Assay Kit (Colorimetric)

Pricing & Availability

Laminin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 72 publications

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Chinese Hamster,Invertebrate,Mammalia,Rabbit,Sheep
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG
Gene Accession No.	P19137
Research Discipline	Angiogenesis, Apoptosis, Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors
Concentration	1 mg/ml
Antigen	Laminin
Gene Symbols	LAMA1
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:100 - 1:5000, Flow Cytometry, Immunohistochemistry 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:500 - 1:2000, Immunohistochemistry-Frozen 1:500 - 1:2000, Immunohistochemistry Free-Floating 1:1000 - 1:5000
Molecular Weight of Antigen	337 kDa
Gene Alias	LAMA, Laminin A chain, laminin subunit alpha-1, laminin, alpha 1, Laminin-1 subunit alpha, Laminin-3 subunit alpha, PTBHS, S-LAM alpha, S-laminin subunit alpha
Gene ID (Entrez)	284217
Formulation	50% PBS, 50% Glycerol with 5mM Sodium Azide
Immunogen	Laminin Antibody was made to Laminin 111 isolated from mouse Engelbreth-Holm-Swarm (EHS) sarcoma cells. [UniProt# P19137]
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Laminin Antibody is pan-specific and reacts well with all Laminin isoforms tested: Laminin-1 (alpha-1, beta-1, and gamma-1) and Laminin-2 (alpha-2, beta-1, and gamma-1).

Ly-6G/Ly-6C Antibody (RB6-8C5) - BSA Free, Novus Biologicals™

Rat Monoclonal Antibody

Pricing & Availability

Recoverin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Form	Purified
Isotype	IgG
Research Discipline	Neuroscience, Vision
Antigen	Recoverin
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	cancer associated retinopathy antigen, Protein CAR, RCV1Cancer-associated retinopathy protein, recoverin
Gene ID (Entrez)	5957
Formulation	PBS (pH 7.3), 50% glycerol
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1).,, Sequence:, MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Classification	Polyclonal
Primary or Secondary	Primary

CD90/Thy1 Antibody (783922), PE, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability

mCherry Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Non-species specific,Mouse,Rat,Bacteria
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),KnockDown
Isotype	IgG
Research Discipline	Cellular Markers, Fusion Proteins
Concentration	1 mg/mL
Antigen	mCherry
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1:1000, Immunohistochemistry 1:500, Immunocytochemistry/Immunofluorescence 1:500, Immunohistochemistry-Paraffin, Live Imaging Microscopy, Immunohistochemistry Whole-Mount, Knockdown Validated, Fluorescence Imaging
Molecular Weight of Antigen	27 kDa
Gene Alias	DSRED, red fluorescent protein mCherry, Red Fluoroscent Protein
Formulation	50% PBS, 50% glycerol with 5mM Sodium Azide
Immunogen	This mCherry Antibody was developed against full length recombinant mCherry protein
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	This antibody detects mCherry.

Novus Biologicals™ Triglyceride Assay Kit (Colorimetric)

Assay Kit (Colorimetric)

Pricing & Availability

RBFOX3/NeuN Antibody (1B7), Alexa Fluor™ 700, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability

Content And Storage	Store at 4°C in the dark. Do not freeze.
For Use With (Application)	Flow Cytometry, Immunocytochemistry/Immunofluorescence, Live Imaging Microscopy

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Peptide Array
Form	Purified
Isotype	IgG2c κ
Research Discipline	Cancer
Concentration	0.2 mg/mL
Antigen	Kallikrein 5
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Immunohistochemistry-Paraffin 1 to 2 μg/mL, Protein Array
Gene Alias	EC 3.4.21, EC 3.4.21.4, kallikrein 5, Kallikrein-like protein 2, kallikrein-related peptidase 5, KLKL2, KLK-L2EC 3.4.21.-, SCTEkallikrein-5, Stratum corneum tryptic enzyme
Gene ID (Entrez)	25818
Formulation	10 mM PBS with 0.05% BSA
Immunogen	Recombinant fragment of human Kallikrein 5 protein (around aa 36-177) (exact sequence is proprietary)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	KLK5/3841

Novus Biologicals™ Mouse Cathepsin G ELISA Kit (Colorimetric)

Mouse Cathepsin G ELISA Kit (Colorimetric) measures Cathepsin G in Serum, plasma, cell supernatant, and other biological fluids.

Pricing & Availability

Prev
1
2
3
4
5
6
...
47,569
Next

Novus Biologicals

Filtered Search Results

Narrow Results

Collagen I Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ LPS from E. Coli, TLR4 ligand Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

alpha-Synuclein Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

SCF/c-kit Ligand Rabbit anti-Human, Clone: 4, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Glucose Assay Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Laminin Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Ly-6G/Ly-6C Antibody (RB6-8C5) - BSA Free, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Recoverin Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

CD90/Thy1 Antibody (783922), PE, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

mCherry Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Triglyceride Assay Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

RBFOX3/NeuN Antibody (1B7), Alexa Fluor™ 700, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DRAQ7™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Mouse Cathepsin G ELISA Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Collagen I Antibody, Novus Biologicals™

Novus Biologicals™ LPS from E. Coli, TLR4 ligand

alpha-Synuclein Antibody, Novus Biologicals™

SCF/c-kit Ligand Rabbit anti-Human, Clone: 4, Novus Biologicals™

Novus Biologicals™ Glucose Assay Kit (Colorimetric)

Laminin Antibody, Novus Biologicals™

Ly-6G/Ly-6C Antibody (RB6-8C5) - BSA Free, Novus Biologicals™

Recoverin Antibody, Novus Biologicals™

CD90/Thy1 Antibody (783922), PE, Novus Biologicals™

mCherry Antibody, Novus Biologicals™

Novus Biologicals™ Triglyceride Assay Kit (Colorimetric)

RBFOX3/NeuN Antibody (1B7), Alexa Fluor™ 700, Novus Biologicals™

Novus Biologicals™ DRAQ7™

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™

Novus Biologicals™ Mouse Cathepsin G ELISA Kit (Colorimetric)