Novus Biologicals

Browse a range of Novus Biologicals antibodies, proteins, stains, kits, research reagents, and other products to support your scientific needs.

Narrow Results

special interests

Small and Specialty Supplier (736,250)

Classification

Monoclonal (373,984)
Polyclonal (311,218)

Regulatory Status

RUO (613,840)

1 – 15 of 689,439 results

Collagen I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 195 publications

Pricing & Availability

Novus Biologicals™ Mouse HMGB1/HMG-1 ELISA Kit (Colorimetric)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Pricing & Availability

Novus Biologicals™ Glucose Assay Kit (Colorimetric)

Assay Kit (Colorimetric)

Pricing & Availability

Novus Biologicals™ Recombinant Human Peroxiredoxin 3 Protein

Highly purified and high bioactivity. Generating reliable and reproducible results.

Pricing & Availability

Novus Biologicals™ Rat Troponin I Type 3 (cardiac) ELISA Kit (Colorimetric)

Rat Troponin I Type 3 (cardiac) ELISA Kit (Colorimetric) measures Troponin I Type 3 (cardiac) in Serum, plasma, cell supernatant, and other biological fluids.

Pricing & Availability

Novus Biologicals™ Rat Creatine Kinase MB ELISA Kit (Colorimetric)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Pricing & Availability

Novus Biologicals™ Recombinant Human Mcl-1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	bcl2-L-3, BCL2L3MGC104264, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT, induced myeloid leukemia cell differentiation protein Mcl-1, Mcl-1, mcl1/EAT, MCL1-ES, MCL1L, MCL1S, MGC1839, myeloid cell leukemia ES, myeloid cell leukemia sequence 1 (BCL2-related), TM
Common Name	Mcl-1
Molecular Weight (g/mol)	TMW: 37.2kDa
Gene ID (Entrez)	4170
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 20% glycerol, 2mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

Novus Biologicals™ LPS from E. Coli, TLR4 ligand

Applications: Functional

Pricing & Availability

Calretinin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunohistochemistry,Immunocytochemistry,Immunohistochemistry (Paraffin),Immunohistochemistry (Free Floating),KnockDown
Form	Purified
Isotype	IgG
Research Discipline	Cellular Markers
Antigen	Calretinin
Regulatory Status	RUO
Purification Method	Immunogen affinity purified
Dilution	Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunohistochemistry Free-Floating, Knockdown Validated
Gene Alias	29 kDa calbindin, CAB29, CAL2, calbindin 2, calbindin 2, (29kD, calretinin), calbindin 2, 29kDa (calretinin), calbindin D29K, calretinin, CR
Gene ID (Entrez)	794
Formulation	PBS (pH 7.2) and 40% Glycerol
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals™ Recombinant Human TCL1A Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

Mouse IgG1 Isotype Control (MG1) [mFluor Violet 450 SE], Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability

Novus Biologicals™ Canine NT-proBNP ELISA Kit (Colorimetric)

Colorimetric ELISA Kit

Pricing & Availability

beta-Actin Antibody (BLR057F), Novus Biologicals™

Rabbit Monoclonal Antibody

Pricing & Availability

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Peptide Array
Form	Purified
Isotype	IgG2c κ
Research Discipline	Cancer
Concentration	0.2 mg/mL
Antigen	Kallikrein 5
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Immunohistochemistry-Paraffin 1 to 2 μg/mL, Protein Array
Gene Alias	EC 3.4.21, EC 3.4.21.4, kallikrein 5, Kallikrein-like protein 2, kallikrein-related peptidase 5, KLKL2, KLK-L2EC 3.4.21.-, SCTEkallikrein-5, Stratum corneum tryptic enzyme
Gene ID (Entrez)	25818
Formulation	10 mM PBS with 0.05% BSA
Immunogen	Recombinant fragment of human Kallikrein 5 protein (around aa 36-177) (exact sequence is proprietary)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	KLK5/3841

alpha-Synuclein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Pricing & Availability

Prev
1
2
3
4
5
6
...
45,963
Next

Novus Biologicals

Filtered Search Results

Narrow Results

Collagen I Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Mouse HMGB1/HMG-1 ELISA Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Glucose Assay Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Peroxiredoxin 3 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Rat Troponin I Type 3 (cardiac) ELISA Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Rat Creatine Kinase MB ELISA Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Mcl-1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ LPS from E. Coli, TLR4 ligand Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Calretinin Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TCL1A Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Mouse IgG1 Isotype Control (MG1) [mFluor Violet 450 SE], Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Canine NT-proBNP ELISA Kit (Colorimetric) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

beta-Actin Antibody (BLR057F), Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

alpha-Synuclein Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More