Abnova Corporation

Designed for the clinical and in vitro diagnostic industries, Abnova products are manufactured in an ISO13485 and GMP-certified facility and an ISO15189 medical laboratory. They include rabbit monoclonal antibodies, ELISA kits, FISH probes, and CytoQuest™ CR systems.

1 – 15 of 86,691 results

Abnova™ Human APC Partial ORF (NP_000029, 2744 a.a. - 2843 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	APC
Molecular Weight (g/mol)	36.85kDa
Gene Symbol	APC
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	APC (Human) Recombinant Protein (Q01)
Accession Number	NP_000029
Regulatory Status	RUO
Gene Alias	BTPS2/DP2/DP2.5/DP3/GS
Gene ID (Entrez)	324
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	NPVPVSETNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human APEH Full-length ORF (NP_001631.3, 1 a.a. - 732 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	APEH
Molecular Weight (g/mol)	107.6kDa
Gene Symbol	APEH
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	APEH (Human) Recombinant Protein (P01)
Accession Number	NP_001631.3
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	ACPH/APH/D3F15S2/D3S48E/DNF15S2/MGC2178/OPH
Gene ID (Entrez)	327
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human APPBP2 Full-length ORF (NP_006371.2, 1 a.a. - 585 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	APPBP2
Molecular Weight (g/mol)	93.3kDa
Gene Symbol	APPBP2
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	APPBP2 (Human) Recombinant Protein (P01)
Accession Number	NP_006371.2
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	HS.84084/KIAA0228/PAT1
Gene ID (Entrez)	10513
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human APPL2 Full-length ORF (AAH33731.1, 1 a.a. - 664 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	APPL2
Molecular Weight (g/mol)	100.9kDa
Gene Symbol	APPL2
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	APPL2 (Human) Recombinant Protein (P01)
Accession Number	AAH33731.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	DIP13B/FLJ10659
Gene ID (Entrez)	55198
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human AQP7 Full-length ORF (NP_001161.1, 1 a.a. - 342 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	AQP7
Molecular Weight (g/mol)	63.6kDa
Gene Symbol	AQP7
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	AQP7 (Human) Recombinant Protein (P01)
Accession Number	NP_001161.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	AQP7L/AQP9/AQPap/MGC149555/MGC149556
Gene ID (Entrez)	364
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human ARHGAP24 Full-length ORF (NP_001036134.1, 1 a.a. - 653 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability

Abnova™ Human APOBEC2 Full-length ORF (NP_006780.1, 1 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	APOBEC2
Molecular Weight (g/mol)	52.1kDa
Gene Symbol	APOBEC2
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	APOBEC2 (Human) Recombinant Protein (P01)
Accession Number	NP_006780.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	ARCD1/ARP1
Gene ID (Entrez)	10930
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human APOL6 Partial ORF (NP_085144.1, 1 a.a. - 76 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	APOL6
Molecular Weight (g/mol)	34.1kDa
Gene Symbol	APOL6
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	APOL6 (Human) Recombinant Protein (Q01)
Accession Number	NP_085144.1
Regulatory Status	RUO
Gene Alias	APOL-VI/APOLVI/DKFZp667M075/FLJ38562/FLJ90164/MGC57495
Gene ID (Entrez)	80830
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKTHKKFTK
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human APPL1 Full-length ORF (NP_036228.1, 1 a.a. - 709 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	APPL1
Molecular Weight (g/mol)	106.1kDa
Gene Symbol	APPL1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	APPL1 (Human) Recombinant Protein (P01)
Accession Number	NP_036228.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	APPL/DIP13alpha
Gene ID (Entrez)	26060
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human ARFGAP1 Full-length ORF (AAH28233, 1 a.a. - 414 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	ARFGAP1
Molecular Weight (g/mol)	71.28kDa
Gene Symbol	ARFGAP1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	ARFGAP1 (Human) Recombinant Protein (P01)
Accession Number	AAH28233
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	ARF1GAP/HRIHFB2281/MGC39924
Gene ID (Entrez)	55738
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human ARHGEF1 Full-length ORF (NP_004697.2, 1 a.a. - 912 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	ARHGEF1
Molecular Weight (g/mol)	128.8kDa
Gene Symbol	ARHGEF1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	ARHGEF1 (Human) Recombinant Protein (P02)
Accession Number	NP_004697.2
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	GEF1/LBCL2/LSC/P115-RHOGEF/SUB1.5
Gene ID (Entrez)	9138
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human APRIN Partial ORF (NP_055847, 1168 a.a. - 1259 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PDS5B
Molecular Weight (g/mol)	35.86kDa
Gene Symbol	PDS5B
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,ELISA,Protein Array,Western Blot
Name	APRIN (Human) Recombinant Protein (Q01)
Accession Number	NP_055847
Regulatory Status	RUO
Gene Alias	APRIN/AS3/CG008/FLJ23236/KIAA0979/RP1-267P19.1
Gene ID (Entrez)	23047
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	GRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASES
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human ARFGAP3 Full-length ORF (NP_055385.2, 1 a.a. - 516 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	ARFGAP3
Molecular Weight (g/mol)	83.4kDa
Gene Symbol	ARFGAP3
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	ARFGAP3 (Human) Recombinant Protein (P01)
Accession Number	NP_055385.2
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	ARFGAP1/FLJ45618
Gene ID (Entrez)	26286
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human ARHGAP25 Full-length ORF (AAH39591.1, 1 a.a. - 458 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	ARHGAP25
Molecular Weight (g/mol)	78.2kDa
Gene Symbol	ARHGAP25
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	ARHGAP25 (Human) Recombinant Protein (P01)
Accession Number	AAH39591.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	KAIA0053
Gene ID (Entrez)	9938
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human ARAF Full-length ORF (AAH07514, 1 a.a. - 609 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability

Prev
1
2
3
4
5
6
...
5,780
Next

Abnova Corporation

Filtered Search Results

Narrow Results