Abnova Corporation

Designed for the clinical and in vitro diagnostic industries, Abnova products are manufactured in an ISO13485 and GMP-certified facility and an ISO15189 medical laboratory. They include rabbit monoclonal antibodies, ELISA kits, FISH probes, and CytoQuest™ CR systems.

Narrow Results

special interests

Available on GSA/VA Contract (2)

Classification

Cocktail (3)
Low Endotoxin/Azide-free (LE/AF) (1)
Monoclonal (29,342)
Monoclonal/Polyclonal (3,638)
Polyclonal (27,687)

Regulatory Status

RUO (55,360)

1 – 15 of 82,492 results

Abnova Corporation EDF1 Rabbit anti-Human, Polyclonal, Abnova™

Rabbit Polyclonal Antibody

Pricing & Availability

Abnova™ Human PAQR3 Full-length ORF (AAH47510.1, 1 a.a. - 269 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability

Abnova™ Human PAQR4 Full-length ORF (NP_689554.2, 1 a.a. - 273 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PAQR4
Molecular Weight (g/mol)	55.5kDa
Gene Symbol	PAQR4
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PAQR4 (Human) Recombinant Protein (P01)
Accession Number	NP_689554.2
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	FLJ30002
Gene ID (Entrez)	124222
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTMPWGQLGKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human PAFAH2 Full-length ORF (NP_000428.2, 1 a.a. - 392 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PAFAH2
Molecular Weight (g/mol)	70.4kDa
Gene Symbol	PAFAH2
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PAFAH2 (Human) Recombinant Protein (P01)
Accession Number	NP_000428.2
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	FLJ26025/HSD-PLA2
Gene ID (Entrez)	5051
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNKRCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova Corporation LARP1 Rabbit anti-Human, Polyclonal, Abnova™

Rabbit Polyclonal Antibody

Pricing & Availability

Abnova™ Human PA2G4 Full-length ORF (NP_006182.2, 1 a.a. - 394 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PA2G4
Molecular Weight (g/mol)	70.2kDa
Gene Symbol	PA2G4
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PA2G4 (Human) Recombinant Protein (P01)
Accession Number	NP_006182.2
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	EBP1/HG4-1/p38-2G4
Gene ID (Entrez)	5036
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova Corporation RYR2 Rabbit anti-Human, Polyclonal, Abnova™

Rabbit Polyclonal Antibody

Pricing & Availability

Abnova™ Human REG3A Full-length ORF (AAH36776, 1 a.a. - 175 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	REG3A
Molecular Weight (g/mol)	44.77kDa
Gene Symbol	REG3A
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	REG3A (Human) Recombinant Protein (P02)
Accession Number	AAH36776
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	HIP/INGAP/PAP/PAP-H/PAP1/PBCGF/REG-III/REG3
Gene ID (Entrez)	5068
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova Corporation ACAT1 Rabbit anti-Human, Polyclonal, Abnova™

Rabbit Polyclonal Antibody

Pricing & Availability

Abnova™ Human PAGE4 Full-length ORF (NP_008934.1, 1 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PAGE4
Molecular Weight (g/mol)	37.6kDa
Gene Symbol	PAGE4
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PAGE4 (Human) Recombinant Protein (P01)
Accession Number	NP_008934.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	FLJ35184/GAGE-9/GAGEC1/JM-27/JM27/PAGE-1/PAGE-4
Gene ID (Entrez)	9506
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human PCDHGB1 Full-length ORF (NP_115266.1, 1 a.a. - 810 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing & Availability
Specifications

Form	Liquid
Common Name	PCDHGB1
Molecular Weight (g/mol)	114.6kDa
Gene Symbol	PCDHGB1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	PCDHGB1 (Human) Recombinant Protein (P01)
Accession Number	NP_115266.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	MGC119466/MGC119467/MGC119469/PCDH-GAMMA-B1
Gene ID (Entrez)	56104
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MQRAREAEMMKSQVLFPFLLSLFCGAISQQIRYTIPEELANGSRVGKLAKDLGLSVRELPTRKLRVSAEDYFNVSLESGDLLVNGRIDREKICGRKLECALEFETVAENPMNVFHVVVVIQDINDNAPRFVAKGIDLEICESALPGVKFSLDSAQDADVEGNSLKLYTINPNQYFSLSTKESPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTDANDNAPVFSQEVYRVSLQENVPWGTSVLRVMATDQDEGINAEITYAFLNSPISTSLFNLNPNTGDITTNGTLDFEETSRYVLSVEAKDGGVHTAHCNVQIEIVDENDNAPEVTFMSFSNQIPEDSDLGTVIALIKVRDKDSGQNGMVTCYTQEEVPFKLESTSKNYYKLVIAGALNREQTADYNVTIIATDKGKPALSSRTSITLHISDINDNAPVFHQASYVVHVSENNPPGASIAQVSASDPDLGPNGRVSYSILASDLEPRELLSYVSVSPQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDLNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLIFADSLQEVLPDLSDRPEPSDPQTELQFYLVVALALISVLFLLAVILAIALRLRRSSSLDTEGCFQTGLCSKSGPGVPPNHSEGTLPYSYNLCIASHSAKTEFNSLNLTPEMAPPQDLLCDDPSMVVCASNEDHKIAYDPSLSSHVSFCKSS
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant